PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G054400.1.p
Common NameLOC100788382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WRKY
Protein Properties Length: 196aa    MW: 21519.8 Da    PI: 9.2069
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G054400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.4e-33116174159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  Glyma.16G054400.1.p 116 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHP 174
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-33101174IPR003657WRKY domain
SuperFamilySSF1182906.28E-30108175IPR003657WRKY domain
PROSITE profilePS5081129.895111176IPR003657WRKY domain
SMARTSM007741.5E-39116175IPR003657WRKY domain
PfamPF031067.5E-27117174IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MENYSMLFPI SNSSSYPIST SGVGSSQIGY NGQSSNAFLG LRPSNELLGS DDHDNGGEGG  60
GDGDGNMLMS QISGGSNTNV SDELGGSGNS NNKKKGEKKV KKPRYAFQTR SQVDILDDGY  120
RWRKYGQKAV KNNKFPRSYY RCTHQGCNVK KQVQRLTKDE GVVVTTYEGV HTHPIEKTTD  180
NFEHILSQMK IYTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-27107173874Probable WRKY transcription factor 4
2lex_A2e-27107173874Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.532220.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0986410.0BT098641.1 Soybean clone JCVI-FLGm-12D20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549123.11e-144PREDICTED: probable WRKY transcription factor 75
TrEMBLA0A0R4J5J21e-144A0A0R4J5J2_SOYBN; Uncharacterized protein
STRINGGLYMA16G05880.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-58WRKY DNA-binding protein 75